PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G106601.1.p
Common NameSb10g009330, SORBIDRAFT_10g009330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 299aa    MW: 31751.8 Da    PI: 4.8018
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G106601.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.7e-151461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  Sobic.010G106601.1.p 14 KGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                          79******************************99************97 PP

2Myb_DNA-binding52.51.2e-1671111547
                           -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           + +E+ l +d+++qlG++ W++Ia+ ++ gRt++++k++w+++
  Sobic.010G106601.1.p  71 SDDEERLVIDLHAQLGNR-WSKIAAQLP-GRTDNEIKNHWNTH 111
                           899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.1961IPR017930Myb domain
SuperFamilySSF466897.86E-2711108IPR009057Homeodomain-like
SMARTSM007173.0E-111363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001677.03E-91661No hitNo description
PROSITE profilePS5129427.43862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2463116IPR009057Homeodomain-like
SMARTSM007177.9E-1566114IPR001005SANT/Myb domain
CDDcd001675.64E-1271112No hitNo description
PfamPF002492.5E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRQPCCDKV GMKKGPWTAE EDQKLVGFLL THGHCCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEERLVID LHAQLGNRWS KIAAQLPGRT DNEIKNHWNT HIRKKLLRMG  120
IDPVTHLPLQ EPPAPPPPPP PPPEQEPDDQ EEEPQQQEQQ AGKLMQEGGA GEDDVAPMVQ  180
PHETIMAPPP PPTTAASNCG SAAVSSASAG SASVVSPSCS SSSASAPAVT GVEATEWPEP  240
VYLFGMDGIM DAGWAGLFPS TGAGAGGCFG LGGVDPFDQY PGVGVGGAGF DQDDGHWM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0375370.0BT037537.1 Zea mays full-length cDNA clone ZM_BFb0176M23 mRNA, complete cds.
GenBankEU9518730.0EU951873.1 Zea mays clone 1061835 odorant 1 protein mRNA, complete cds.
GenBankJX4699450.0JX469945.1 Zea mays subsp. mays clone UT3206 MYB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436815.10.0hypothetical protein SORBIDRAFT_10g009330
SwissprotQ50EX62e-84ODO1_PETHY; Protein ODORANT1
TrEMBLC5Z8150.0C5Z815_SORBI; Putative uncharacterized protein Sb10g009330
STRINGSb10g009330.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.15e-80myb domain protein 20